PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g080790.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 662aa    MW: 73894.2 Da    PI: 6.0001
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g080790.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82e-094204571954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  Sopim04g080790.0.1 420 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 457
                         554459******************************88 PP

2BELL1231.3e-39286357172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         er++l++k +kL s+l+eVd+rYk y++q+q+v+ssFe+vaglg+akpYtslAlk+iSr+FrcL+dai++qi
  Sopim04g080790.0.1 286 ERHDLESKMTKLFSMLDEVDRRYKEYYQQMQVVVSSFEMVAGLGAAKPYTSLALKTISRQFRCLRDAIKKQI 357
                         799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-56210355IPR006563POX domain
PfamPF075262.9E-47216353IPR006563POX domain
PROSITE profilePS5007112.341398461IPR001356Homeobox domain
SMARTSM003894.4E-10401465IPR001356Homeobox domain
CDDcd000869.57E-13401462No hitNo description
SuperFamilySSF466892.48E-17402468IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-28404467IPR009057Homeodomain-like
PfamPF059202.2E-17418457IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MSAYYSNLSN QREVLPMSFL PDQKFASYQS TGLSDSPVHL NQHSASVSYS ELPSQNYSEV  60
QTLKGKDEML FIPPTSESGG MQPIGRAVNA VPNFLENSVM MDPHSFPIKQ LLVPNGEQSL  120
QNQGLSLSLG TQVPPSLHVY SYQDDYTNSS LSSLVGTHVL HSDQGSENKE SKVAEYLSFD  180
LAGGSRAANN PQSSMTLREL NSGVHSHVGS GAAAAIYNSK YLKAAQDLLD EVVNVQEALK  240
QSDKLRNFNL LSHDRSEEAD FKSSSSATGI SDDHNNSTKG ELSATERHDL ESKMTKLFSM  300
LDEVDRRYKE YYQQMQVVVS SFEMVAGLGA AKPYTSLALK TISRQFRCLR DAIKKQIQVT  360
RRSLGEQGDS QGERLYRLRY VDQQLRQQRS LQQFGMMRQP WRPQRGLPET AVSVLRAWLF  420
EHFLHPYPKD SEKIMLARQT GLTRSQVANW FINARVRLWK PMIEDMYKEE FGVAEAGSGA  480
SPERVAVDSK EKSIAENTGE DIPESFTIPA ANCSHLDPSD ESSNIVTNVH NNSFTTKFSF  540
QDGDYEHDRI DCGSNKLQSE QIPIAHRFGP KPTSDGSIIG PVNTYHPSML GDIMGNQVSL  600
ALRLQNSQMD QQPISGRPQL RQDEKTDSTH VDISKGEYYY IDPVNQQERF SGSHLLSDFV  660
V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B8e-17407464158Homeobox protein Meis1
4xrs_A8e-17407464158Homeobox protein Meis1
3k2a_B1e-16407464562Homeobox protein Meis2
3k2a_A1e-16407464562Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004238265.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010320401.10.0PREDICTED: BEL1-like homeodomain protein 3
RefseqXP_010320402.10.0PREDICTED: BEL1-like homeodomain protein 3
TrEMBLK4BVF80.0K4BVF8_SOLLC; Uncharacterized protein
STRINGSolyc04g080790.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112582022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.21e-102BEL1-like homeodomain 3